PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013585973.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 810aa    MW: 90558 Da    PI: 5.8429
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013585973.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.85.2e-29529579252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      k+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  XP_013585973.1 529 DKTITLDVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIQRWPSRKIKKV 579
                     689**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.166516599IPR003035RWP-RK domain
PfamPF020421.8E-25531579IPR003035RWP-RK domain
SuperFamilySSF542771.54E-22703798No hitNo description
PROSITE profilePS5174528.566710793IPR000270PB1 domain
SMARTSM006662.7E-26710793IPR000270PB1 domain
PfamPF005646.4E-19711792IPR000270PB1 domain
CDDcd064071.39E-43711792No hitNo description
Gene3DG3DSA:3.10.20.2401.0E-20711790No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 810 aa     Download sequence    Send to blast
MEDSFLQTQN AVMDTEFMDG LLLDGCWLET TDGSEFLNLP PFDPSSFMWS PPQDTSAICT  60
SGVVSQTYGQ DCADEFQYNK RWWIGPGGGG GSSVTERLVQ AVEHIKDYTT ERGSLIQLWV  120
PVNRGGKRVL TTKEQPFSHD PMCQRLANYR EISVNYHFSA EQDDSKALAG LPGRVFLGKL  180
PEWTPDVRFF KSEEYPRVQH AQDCDVRGTL AIPVFEQGSK ICLGVIEVVM TTEMVKLKPE  240
LESICRALQA VDLRSTELPV PPSLKGCDLS YKAALPEIRN LLRCACETHK LPLAQTWVSC  300
LQQSKSGCRH NDENYIHCVS TIDEACYLGD PTVREFQEAC SEHHLLKGQG VAGQAFLTNG  360
PCFSPDVANY KKSEYPLSHH ANMFGLHGAV AIRLRCIHTG DADFVLEFFL PKDCDNMGEQ  420
RKMLNALSTI MAHVPRSLRT VTDKELEEES EVVEREEVVT PKVENTPELH HSNPQNLGLV  480
FDGGDKLPND GFGLKRGYDY TRDANINESN TFTIGGFNSM AEKKRTKADK TITLDVLRQY  540
FAGSLKDAAK SIGVCPTTLK RICRQHGIQR WPSRKIKKVG HSLQKIQRVI DSVEGVSGPL  600
PIGSFYANFP NLEPSQQAKT SPPPPPPPPL QLSKSPVSQY SHSSSSSQCC SSETQLNSSA  660
TAHPSQGDTF RKVSSEVDLQ SSVLTLSSLE NIPQGQGTHL LSSSSQDDDF LRIKVSYGEE  720
NIRFRMKNSR RLSDLLWEIG KRFSIEDMSR YDLKYLDEDN EWVLLTCDED VEECVDVCRT  780
TPSHTIKLLL HASSHHFPER SSPTGYTLWQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892470.0AC189247.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB018K09, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013585973.10.0PREDICTED: protein NLP4 isoform X1
RefseqXP_013585974.10.0PREDICTED: protein NLP4 isoform X1
RefseqXP_013717637.10.0PREDICTED: protein NLP4
RefseqXP_013717638.10.0PREDICTED: protein NLP4
RefseqXP_013717640.10.0PREDICTED: protein NLP4
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLA0A0D3CBU50.0A0A0D3CBU5_BRAOL; Uncharacterized protein
STRINGBra025834.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein